PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G12000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 66aa    MW: 7210.2 Da    PI: 8.227
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G12000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP58.71.5e-1829651248
                     TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
              SBP 12 seakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
                     s++++yhrrhkvCe+h+k+pvv+v+g+eqrfCqqCsr
  OPUNC11G12000.1 29 SRCRDYHRRHKVCEAHAKTPVVVVAGQEQRFCQQCSR 65
                     689*********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114115.0841066IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.98E-172966IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.5E-172965IPR004333Transcription factor, SBP-box
PfamPF031101.3E-133065IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MEWAAASWGM AAAAADDAGP TMLSFAGPSR CRDYHRRHKV CEAHAKTPVV VVAGQEQRFC  60
QQCSRC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1336081e-51AC133608.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0085G12, complete sequence.
GenBankAC1355691e-51AC135569.6 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0018F17, complete sequence.
GenBankAP0149671e-51AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126191e-51CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577554.12e-19PREDICTED: putative squamosa promoter-binding-like protein 19
RefseqXP_014757434.12e-19PREDICTED: putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-20SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A0E0MFM68e-43A0A0E0MFM6_ORYPU; Uncharacterized protein
STRINGBRADI4G18890.16e-20(Brachypodium distachyon)
STRINGORGLA11G0121600.12e-18(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.18e-16SBP family protein